JAM3 Antikörper (N-Term)

Produktnummer ABIN635598

Produktdetails anti-JAM3 Antikörper

Target: JAM3 (Junctional Adhesion Molecule 3 (JAM3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser JAM3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: JAM3 antibody was raised against the N terminal of JAM3

Aufreinigung: Affinity purified

Immunogen: JAM3 antibody was raised using the N terminal of JAM3 corresponding to a region with amino acids SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

JAM3 Blocking Peptide, catalog no. 33R-8834, is also available for use as a blocking control in assays to test for specificity of this JAM3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAM3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu JAM3

Target: JAM3 (Junctional Adhesion Molecule 3 (JAM3))

Andere Bezeichnung: JAM3 (JAM3 Produkte)

Synonyme: JAM3 antikoerper, jam3 antikoerper, sr:nyz155 antikoerper, wu:fb30h11 antikoerper, wu:fc08c06 antikoerper, wu:fc13e04 antikoerper, wu:fc25g11 antikoerper, jamc.2 antikoerper, 1110002N23Rik antikoerper, JAM-3 antikoerper, JAM-C antikoerper, Jcam3 antikoerper, JAM-2 antikoerper, JAMC antikoerper, junctional adhesion molecule 3 antikoerper, junctional adhesion molecule 3b antikoerper, junctional adhesion molecule 3a antikoerper, junction adhesion molecule 3 antikoerper, JAM3 antikoerper, jam3b antikoerper, jam3a antikoerper, Jam3 antikoerper

Hintergrund: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. JAM3, one member of the immunoglobulin superfamily, is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. JAM3 is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family.

Molekulargewicht: 28 kDa (MW of target protein)