COX3 Antikörper (C-Term)

Produktnummer ABIN635599

Produktdetails anti-COX3 Antikörper

Target: COX3 (COX-3) (Cytochrome C Oxidase Subunit 3 (COX-3))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COX3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: COX3 antibody was raised against the C terminal of COX3

Aufreinigung: Affinity purified

Immunogen: COX3 antibody was raised using the C terminal of COX3 corresponding to a region with amino acids FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

COX3 Blocking Peptide, catalog no. 33R-2880, is also available for use as a blocking control in assays to test for specificity of this COX3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COX3

Target: COX3 (COX-3) (Cytochrome C Oxidase Subunit 3 (COX-3))

Andere Bezeichnung: COX3 (COX-3 Produkte)

Synonyme: COIII antikoerper, MTCO3 antikoerper, cytochrome c oxidase III antikoerper, cytochrome c oxidase subunit III antikoerper, cytochrome c oxidase subunit 3 antikoerper, cytochrome oxidasesubunit 3 antikoerper, COX3 antikoerper, cox3 antikoerper

Hintergrund: COX3 is a multi-pass membrane protein. It belongs to the cytochrome c oxidase subunit 3 family. Defects in COX3 are a cause of Leber hereditary optic neuropathy (LHON) and cytochrome c oxidase deficiency (COX deficiency). Defects in MT-CO3 are also found in mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes (MELAS) syndrome and recurrent myoglobinuria.

Molekulargewicht: 29 kDa (MW of target protein)