COX3 Antikörper (C-Term)
-
- Target Alle COX3 (COX-3) Antikörper anzeigen
- COX3 (COX-3) (Cytochrome C Oxidase Subunit 3 (COX-3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser COX3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- COX3 antibody was raised against the C terminal of COX3
- Aufreinigung
- Affinity purified
- Immunogen
- COX3 antibody was raised using the C terminal of COX3 corresponding to a region with amino acids FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKH
- Top Product
- Discover our top product COX-3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
COX3 Blocking Peptide, catalog no. 33R-2880, is also available for use as a blocking control in assays to test for specificity of this COX3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COX3 (COX-3) (Cytochrome C Oxidase Subunit 3 (COX-3))
- Andere Bezeichnung
- COX3 (COX-3 Produkte)
- Hintergrund
- COX3 is a multi-pass membrane protein. It belongs to the cytochrome c oxidase subunit 3 family. Defects in COX3 are a cause of Leber hereditary optic neuropathy (LHON) and cytochrome c oxidase deficiency (COX deficiency). Defects in MT-CO3 are also found in mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes (MELAS) syndrome and recurrent myoglobinuria.
- Molekulargewicht
- 29 kDa (MW of target protein)
-