C1orf159 Antikörper (C-Term)

Produktnummer ABIN635604

Produktdetails anti-C1orf159 Antikörper

Target: C1orf159 (Chromosome 1 Open Reading Frame 159 (C1orf159))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1orf159 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 ORF159 antibody was raised against the C terminal Of C1 rf159

Aufreinigung: Affinity purified

Immunogen: C1 ORF159 antibody was raised using the C terminal Of C1 rf159 corresponding to a region with amino acids PLPGSPGDPPTRQGQGRIWLVPPALDLSWIWPAPPARPPLIPVTSMLFPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF159 Blocking Peptide, catalog no. 33R-7201, is also available for use as a blocking control in assays to test for specificity of this C1ORF159 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF159 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1orf159

Target: C1orf159 (Chromosome 1 Open Reading Frame 159 (C1orf159))

Andere Bezeichnung: C1ORF159 (C1orf159 Produkte)

Synonyme: DKFZp459M0116 antikoerper, chromosome 21 C1orf159 homolog antikoerper, chromosome 1 open reading frame 159 antikoerper, chromosome 1 open reading frame, human C1orf159 antikoerper, C21H1orf159 antikoerper, c1orf159 antikoerper, C1H1orf159 antikoerper, C1orf159 antikoerper

Hintergrund: The function of C1orf159 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 42 kDa (MW of target protein)