SERINC2 Antikörper (N-Term)

Produktnummer ABIN635607

Produktdetails anti-SERINC2 Antikörper

Target: SERINC2 (serine Incorporator 2 (SERINC2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SERINC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SERINC2 antibody was raised against the N terminal of SERINC2

Aufreinigung: Affinity purified

Immunogen: SERINC2 antibody was raised using the N terminal of SERINC2 corresponding to a region with amino acids VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SERINC2 Blocking Peptide, catalog no. 33R-9449, is also available for use as a blocking control in assays to test for specificity of this SERINC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERINC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SERINC2

Target: SERINC2 (serine Incorporator 2 (SERINC2))

Andere Bezeichnung: SERINC2 (SERINC2 Produkte)

Synonyme: 2310004K20Rik antikoerper, AW121759 antikoerper, FKSG84 antikoerper, TDE2 antikoerper, Tde2l antikoerper, PRO0899 antikoerper, TDE2L antikoerper, serine incorporator 2 antikoerper, Serinc2 antikoerper, SERINC2 antikoerper

Hintergrund: The function of SERINC2 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 51 kDa (MW of target protein)