FLJ20489 (C-Term) Antikörper
-
- Target
- FLJ20489
- Bindungsspezifität
- C-Term
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB)
- Spezifität
- FLJ20489 antibody was raised against the C terminal of FLJ20489
- Aufreinigung
- Affinity purified
- Immunogen
- FLJ20489 antibody was raised using the C terminal of FLJ20489 corresponding to a region with amino acids LISGDSPASAFQSAGIIGVSHRARPGSVFLARSEESLYLRPGQQSQEVKV
-
anti-FLJ20489 (C-Term) antibody
Reaktivität: Human IHC, WB Wirt: Kaninchen Polyclonal unconjugated
anti-FLJ20489 antibodyReaktivität: Human IHC, WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.0625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FLJ20489 Blocking Peptide, catalog no. 33R-5063, is also available for use as a blocking control in assays to test for specificity of this FLJ20489 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ20489 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FLJ20489
- Hintergrund
- FLJ20489 is a heme transporter that regulates intracellular heme availability through the endosomal or lysosomal compartment.
- Molekulargewicht
- 26 kDa (MW of target protein)
-
