SLC38A3 Antikörper (N-Term)

Produktnummer ABIN635610

Produktdetails anti-SLC38A3 Antikörper

Target: SLC38A3 (Solute Carrier Family 38 Member 3 (SLC38A3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC38A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC38 A3 antibody was raised against the N terminal of SLC38 3

Aufreinigung: Affinity purified

Immunogen: SLC38 A3 antibody was raised using the N terminal of SLC38 3 corresponding to a region with amino acids GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC38A3 Blocking Peptide, catalog no. 33R-3456, is also available for use as a blocking control in assays to test for specificity of this SLC38A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC38A3

Target: SLC38A3 (Solute Carrier Family 38 Member 3 (SLC38A3))

Andere Bezeichnung: SLC38A3 (SLC38A3 Produkte)

Synonyme: slc38a3 antikoerper, wu:fc31c02 antikoerper, wu:fc48a10 antikoerper, zgc:92015 antikoerper, MGC69392 antikoerper, G17 antikoerper, NAT1 antikoerper, SN1 antikoerper, 0610012J02Rik antikoerper, D9Ucla2 antikoerper, Nat1 antikoerper, Slc38-3 antikoerper, Sn1 antikoerper, Snat3 antikoerper, mNAT antikoerper, solute carrier family 38, member 5b antikoerper, solute carrier family 38 member 3 antikoerper, solute carrier family 38, member 3 antikoerper, slc38a5b antikoerper, slc38a3 antikoerper, SLC38A3 antikoerper, Slc38a3 antikoerper

Hintergrund: As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognises histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and play a role in nitrogen metabolism and synaptic transmission.

Molekulargewicht: 56 kDa (MW of target protein)