CLMN Antikörper

Produktnummer ABIN635615

Produktdetails anti-CLMN Antikörper

Target: CLMN (Calmin (CLMN))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLMN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Calmin antibody was raised using a synthetic peptide corresponding to a region with amino acids SPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRKAIKALLAWVQRK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Calmin Blocking Peptide, catalog no. 33R-8697, is also available for use as a blocking control in assays to test for specificity of this Calmin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLMN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLMN

Target: CLMN (Calmin (CLMN))

Andere Bezeichnung: Calmin (CLMN Produkte)

Synonyme: 9330188N17Rik antikoerper, AI428889 antikoerper, AI788815 antikoerper, mKIAA1188 antikoerper, uncharacterized protein PFB0145c antikoerper, calmin antikoerper, LOC5569762 antikoerper, CpipJ_CPIJ015331 antikoerper, Clmn antikoerper, CLMN antikoerper

Hintergrund: CLMN is a single-pass type IV membrane protein. It contains 1 actin-binding domain and 2 CH (calponin-homology) domains. The exact function of CLMN remains unknown.

Molekulargewicht: 110 kDa (MW of target protein)