Klotho beta Antikörper (Middle Region)

Produktnummer ABIN635626

Produktdetails anti-Klotho beta Antikörper

Target: Klotho beta (KLB)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Klotho beta Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Klotho Beta antibody was raised against the middle region of KLB

Aufreinigung: Affinity purified

Immunogen: Klotho Beta antibody was raised using the middle region of KLB corresponding to a region with amino acids DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Klotho Beta Blocking Peptide, catalog no. 33R-1868, is also available for use as a blocking control in assays to test for specificity of this Klotho Beta antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Klotho beta

Target: Klotho beta (KLB)

Andere Bezeichnung: Klotho beta (KLB Produkte)

Synonyme: KLB antikoerper, BKL antikoerper, AV071179 antikoerper, betaKlotho antikoerper, Klb-ps1 antikoerper, RGD1308227 antikoerper, klotho beta antikoerper, KLB antikoerper, Klb antikoerper

Hintergrund: KLB is a single-pass type III membrane protein. It contributes to the transcriptional repression of cholesterol 7-alpha-hydroxylase (CYP7A1), the rate-limiting enzyme in bile acid synthesis. KLB is probably inactive as a glycosidase. It increases the ability of FGFR1 and FGFR4 to bind FGF21.

Molekulargewicht: 120 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Growth Factor Binding