TMEM146 Antikörper (N-Term)

Produktnummer ABIN635627

Produktdetails anti-TMEM146 Antikörper

Target: TMEM146 (Transmembrane Protein 146 (TMEM146))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM146 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM146 antibody was raised against the N terminal of TMEM146

Aufreinigung: Affinity purified

Immunogen: TMEM146 antibody was raised using the N terminal of TMEM146 corresponding to a region with amino acids LIQDVQGDRLYFHPTTTRLIKHPCEKNIALYLGKQVFFTMDNFETSLLPF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM146 Blocking Peptide, catalog no. 33R-5061, is also available for use as a blocking control in assays to test for specificity of this TMEM146 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM146 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM146

Target: TMEM146 (Transmembrane Protein 146 (TMEM146))

Andere Bezeichnung: TMEM146 (TMEM146 Produkte)

Synonyme: TMEM146 antikoerper, 4921529N20Rik antikoerper, 4933402B14Rik antikoerper, 619718 antikoerper, AW045609 antikoerper, Gm6095 antikoerper, Tmem146 antikoerper, cation channel sperm associated auxiliary subunit delta antikoerper, CATSPERD antikoerper, Catsperd antikoerper

Hintergrund: TMEM146 is a single-pass type I membrane protein. The functions of TMEM146 remain unknown.

Molekulargewicht: 90 kDa (MW of target protein)