SAMD8 Antikörper (Middle Region)
-
- Target Alle SAMD8 Produkte
- SAMD8 (Sterile alpha Motif Domain Containing 8 (SAMD8))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SAMD8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SAMD8 antibody was raised against the middle region of SAMD8
- Aufreinigung
- Affinity purified
- Immunogen
- SAMD8 antibody was raised using the middle region of SAMD8 corresponding to a region with amino acids MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SAMD8 Blocking Peptide, catalog no. 33R-6349, is also available for use as a blocking control in assays to test for specificity of this SAMD8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMD8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SAMD8 (Sterile alpha Motif Domain Containing 8 (SAMD8))
- Andere Bezeichnung
- SAMD8 (SAMD8 Produkte)
- Hintergrund
- SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.
- Molekulargewicht
- 36 kDa (MW of target protein)
-