ZDHHC18 Antikörper (Middle Region)
-
- Target Alle ZDHHC18 Antikörper anzeigen
- ZDHHC18 (Zinc Finger, DHHC-Type Containing 18 (ZDHHC18))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZDHHC18 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ZDHHC18 antibody was raised against the middle region of ZDHHC18
- Aufreinigung
- Affinity purified
- Immunogen
- ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids FSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSII
- Top Product
- Discover our top product ZDHHC18 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZDHHC18 Blocking Peptide, catalog no. 33R-3066, is also available for use as a blocking control in assays to test for specificity of this ZDHHC18 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC18 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZDHHC18 (Zinc Finger, DHHC-Type Containing 18 (ZDHHC18))
- Andere Bezeichnung
- ZDHHC18 (ZDHHC18 Produkte)
- Synonyme
- fi45c03 antikoerper, wu:fi45c03 antikoerper, wu:fj48h10 antikoerper, zgc:55843 antikoerper, zdhhc18 antikoerper, zgc:153461 antikoerper, DHHC-18 antikoerper, DHHC18 antikoerper, zinc finger, DHHC-type containing 18b antikoerper, zinc finger, DHHC-type containing 18a antikoerper, zinc finger DHHC-type containing 18 antikoerper, zinc finger, DHHC domain containing 18 antikoerper, zinc finger, DHHC-type containing 18 antikoerper, zdhhc18b antikoerper, zdhhc18a antikoerper, ZDHHC18 antikoerper, Zdhhc18 antikoerper
- Hintergrund
- ZDHHC18 has palmitoyltransferase activity towards HRAS and LCK.
- Molekulargewicht
- 42 kDa (MW of target protein)
-