C5ORF4 Antikörper (N-Term)

Produktnummer ABIN635643

Produktdetails anti-C5ORF4 Antikörper

Target: C5ORF4 (FAXDC2) (Fatty Acid Hydroxylase Domain Containing 2 (FAXDC2))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C5ORF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: C5 ORF4 antibody was raised against the N terminal Of C5 rf4

Aufreinigung: Affinity purified

Immunogen: C5 ORF4 antibody was raised using the N terminal Of C5 rf4 corresponding to a region with amino acids MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C5ORF4 Blocking Peptide, catalog no. 33R-6138, is also available for use as a blocking control in assays to test for specificity of this C5ORF4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C5ORF4

Target: C5ORF4 (FAXDC2) (Fatty Acid Hydroxylase Domain Containing 2 (FAXDC2))

Andere Bezeichnung: C5ORF4 (FAXDC2 Produkte)

Synonyme: C5orf4 antikoerper, fatty acid hydroxylase domain containing 2 antikoerper, FAXDC2 antikoerper

Hintergrund: C5ORF4 is involved in the fatty acid biosynthetic process.

Molekulargewicht: 21 kDa (MW of target protein)