Pannexin 3 Antikörper (Middle Region)
-
- Target Alle Pannexin 3 (PANX3) Antikörper anzeigen
- Pannexin 3 (PANX3)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Säugetier
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Pannexin 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Pannexin 3 antibody was raised against the middle region of PANX3
- Kreuzreaktivität
- Human, Maus, Ratte (Rattus)
- Aufreinigung
- Affinity purified
- Immunogen
- Pannexin 3 antibody was raised using the middle region of PANX3 corresponding to a region with amino acids IISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLL
- Top Product
- Discover our top product PANX3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Pannexin 3 Blocking Peptide, catalog no. 33R-4008, is also available for use as a blocking control in assays to test for specificity of this Pannexin 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANX3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Pannexin 3 (PANX3)
- Andere Bezeichnung
- Pannexin 3 (PANX3 Produkte)
- Hintergrund
- The protein encoded by this gene belongs to the innexin family. Innexin family members are known to be the structural components of gap junctions.
- Molekulargewicht
- 45 kDa (MW of target protein)
-