DENND1B Antikörper (N-Term)
-
- Target Alle DENND1B Antikörper anzeigen
- DENND1B (DENN/MADD Domain Containing 1B (DENND1B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DENND1B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DENND1 B antibody was raised against the N terminal of DENND1
- Aufreinigung
- Affinity purified
- Immunogen
- DENND1 B antibody was raised using the N terminal of DENND1 corresponding to a region with amino acids YKLLNTLADYLAKELENDLNETLRSLYNHPVPKANTPVNLSVNQEIFIAC
- Top Product
- Discover our top product DENND1B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DENND1B Blocking Peptide, catalog no. 33R-10151, is also available for use as a blocking control in assays to test for specificity of this DENND1B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DENND0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DENND1B (DENN/MADD Domain Containing 1B (DENND1B))
- Andere Bezeichnung
- DENND1B (DENND1B Produkte)
- Synonyme
- C1ORF18 antikoerper, C1orf218 antikoerper, FAM31B antikoerper, 4632404N19Rik antikoerper, 4930467M19Rik antikoerper, 6820401H01Rik antikoerper, F730008N07Rik antikoerper, Fam31b antikoerper, si:ch211-195i21.1 antikoerper, DENN domain containing 1B antikoerper, DENN/MADD domain containing 1B antikoerper, DENND1B antikoerper, dennd1b antikoerper, Dennd1b antikoerper
- Hintergrund
- DENND1B contains 1 dDENN domain, 1 DENN domain and 1 uDENN domain. The function of the DENND1B protein remains unknown.
- Molekulargewicht
- 45 kDa (MW of target protein)
-