STOML3 Antikörper

Produktnummer ABIN635649

Produktdetails anti-STOML3 Antikörper

Target: STOML3 (Stomatin (EPB72)-Like 3 (STOML3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STOML3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: STOML3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STOML3 Blocking Peptide, catalog no. 33R-8431, is also available for use as a blocking control in assays to test for specificity of this STOML3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STOML3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STOML3

Target: STOML3 (Stomatin (EPB72)-Like 3 (STOML3))

Andere Bezeichnung: STOML3 (STOML3 Produkte)

Synonyme: Epb7.2l antikoerper, SLP3 antikoerper, sro antikoerper, SRO antikoerper, zgc:110200 antikoerper, stoml3 antikoerper, zgc:165564 antikoerper, stomatin (Epb7.2)-like 3 antikoerper, stomatin like 3 antikoerper, stomatin (EPB72)-like 3b antikoerper, stomatin like 3 L homeolog antikoerper, stomatin (EPB72)-like 3a antikoerper, Stoml3 antikoerper, STOML3 antikoerper, stoml3b antikoerper, stoml3.L antikoerper, stoml3a antikoerper

Hintergrund: The function of STOML3 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 32 kDa (MW of target protein)