TMEM161B Antikörper (N-Term)

Produktnummer ABIN635653

Produktdetails anti-TMEM161B Antikörper

Target: TMEM161B (Transmembrane Protein 161B (TMEM161B))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM161B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM161 B antibody was raised against the N terminal of TMEM161

Aufreinigung: Affinity purified

Immunogen: TMEM161 B antibody was raised using the N terminal of TMEM161 corresponding to a region with amino acids GSLRWYQHPTEEELRILAGKQQKGKTKKDRKYNGHIESKPLTIPKDIDLH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM161B Blocking Peptide, catalog no. 33R-3573, is also available for use as a blocking control in assays to test for specificity of this TMEM161B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM160 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM161B

Target: TMEM161B (Transmembrane Protein 161B (TMEM161B))

Andere Bezeichnung: TMEM161B (TMEM161B Produkte)

Synonyme: FLB3342 antikoerper, PRO1313 antikoerper, 2810446P07Rik antikoerper, AI843389 antikoerper, RGD1309660 antikoerper, id:ibd2207 antikoerper, wu:fc31d04 antikoerper, zgc:63626 antikoerper, transmembrane protein 161B antikoerper, TMEM161B antikoerper, Tmem161b antikoerper, tmem161b antikoerper

Hintergrund: The function of TMEM161 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 55 kDa (MW of target protein)