FLJ90709 (Middle Region) Antikörper
-
- Target
- FLJ90709
- Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FLJ90709 antibody was raised against the middle region of Flj90709
- Aufreinigung
- Affinity purified
- Immunogen
- FLJ90709 antibody was raised using the middle region of Flj90709 corresponding to a region with amino acids VLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNS
-
anti-FLJ90709 (Middle Region) antibody
Reaktivität: Human, Hund, Meerschweinchen, Pferd, Maus, Kaninchen, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-FLJ90709 antibodyReaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FLJ90709 Blocking Peptide, catalog no. 33R-9677, is also available for use as a blocking control in assays to test for specificity of this FLJ90709 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ90709 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FLJ90709
- Hintergrund
- The function of FLJ90709 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 64 kDa (MW of target protein)
-
