DPY19L2 Antikörper

Produktnummer ABIN635657

Produktdetails anti-DPY19L2 Antikörper

Target: DPY19L2 (Dpy-19-Like 2 (DPY19L2))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPY19L2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DPY19 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPY19L2 Blocking Peptide, catalog no. 33R-3998, is also available for use as a blocking control in assays to test for specificity of this DPY19L2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPY10 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPY19L2

Target: DPY19L2 (Dpy-19-Like 2 (DPY19L2))

Andere Bezeichnung: DPY19L2 (DPY19L2 Produkte)

Synonyme: SPATA34 antikoerper, SPGF9 antikoerper, Dyp19l2 antikoerper, RGD1564311 antikoerper, 4932443J21Rik antikoerper, Gm18376 antikoerper, DPY19L2 antikoerper, dpy-19 like 2 antikoerper, probable C-mannosyltransferase DPY19L2 antikoerper, dpy-19-like 2 (C. elegans) antikoerper, DPY19L2 antikoerper, LOC100460030 antikoerper, Dpy19l2 antikoerper

Hintergrund: The function of DPY19L2 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 87 kDa (MW of target protein)