SUSD3 Antikörper (N-Term)
-
- Target Alle SUSD3 Antikörper anzeigen
- SUSD3 (Sushi Domain Containing 3 (SUSD3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SUSD3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SUSD3 antibody was raised against the N terminal of SUSD3
- Aufreinigung
- Affinity purified
- Immunogen
- SUSD3 antibody was raised using the N terminal of SUSD3 corresponding to a region with amino acids LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW
- Top Product
- Discover our top product SUSD3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SUSD3 Blocking Peptide, catalog no. 33R-5371, is also available for use as a blocking control in assays to test for specificity of this SUSD3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUSD3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SUSD3 (Sushi Domain Containing 3 (SUSD3))
- Andere Bezeichnung
- SUSD3 (SUSD3 Produkte)
- Synonyme
- 1700017I11Rik antikoerper, 2810440J20Rik antikoerper, sushi domain containing 3 antikoerper, SUSD3 antikoerper, Susd3 antikoerper
- Hintergrund
- The function of SUSD3 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 27 kDa (MW of target protein)
-