HSD3B1 Antikörper (N-Term)

Produktnummer ABIN635665

Produktdetails anti-HSD3B1 Antikörper

Target: HSD3B1 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 1 (HSD3B1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSD3B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HSD3 B1 antibody was raised against the N terminal of HSD3 1

Aufreinigung: Affinity purified

Immunogen: HSD3 B1 antibody was raised using the N terminal of HSD3 1 corresponding to a region with amino acids TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSD3B1 Blocking Peptide, catalog no. 33R-9099, is also available for use as a blocking control in assays to test for specificity of this HSD3B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSD3B1

Target: HSD3B1 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 1 (HSD3B1))

Andere Bezeichnung: HSD3B1 (HSD3B1 Produkte)

Synonyme: 3BETAHSD antikoerper, HSD3B antikoerper, HSDB3 antikoerper, HSDB3A antikoerper, I antikoerper, SDR11E1 antikoerper, HSD3B1 antikoerper, MGC131206 antikoerper, D3Ertd383e antikoerper, 3B-HSD antikoerper, 3BHSD antikoerper, si:rp71-68n21.10 antikoerper, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1 antikoerper, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 antikoerper, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1 L homeolog antikoerper, HSD3B1 antikoerper, LOC469446 antikoerper, LOC713091 antikoerper, hsd3b1.L antikoerper, LOC100451655 antikoerper, Hsd3b1 antikoerper, hsd3b1 antikoerper

Hintergrund: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, C21-Steroid Hormone Metabolic Process, Carbohydrate Homeostasis