P2RY12 Antikörper (N-Term)

Produktnummer ABIN635667

Produktdetails anti-P2RY12 Antikörper

Target: P2RY12 (Purinergic Receptor P2Y, G-Protein Coupled, 12 (P2RY12))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser P2RY12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: P2 RY12 antibody was raised against the N terminal of P2 Y12

Aufreinigung: Affinity purified

Immunogen: P2 RY12 antibody was raised using the N terminal of P2 Y12 corresponding to a region with amino acids VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

P2RY12 Blocking Peptide, catalog no. 33R-9419, is also available for use as a blocking control in assays to test for specificity of this P2RY12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 Y12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu P2RY12

Target: P2RY12 (Purinergic Receptor P2Y, G-Protein Coupled, 12 (P2RY12))

Andere Bezeichnung: P2RY12 (P2RY12 Produkte)

Synonyme: 2900079B22Rik antikoerper, 4921504D23Rik antikoerper, P2Y12 antikoerper, ADPG-R antikoerper, BDPLT8 antikoerper, HORK3 antikoerper, P2T(AC) antikoerper, P2Y(12)R antikoerper, P2Y(AC) antikoerper, P2Y(ADP) antikoerper, P2Y(cyc) antikoerper, SP1999 antikoerper, P2y12 antikoerper, purinergic receptor P2Y, G-protein coupled 12 antikoerper, purinergic receptor P2Y12 antikoerper, P2ry12 antikoerper, P2RY12 antikoerper

Hintergrund: P2RY12 belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelets aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders.

Molekulargewicht: 39 kDa (MW of target protein)