TMEM63A Antikörper (N-Term)
-
- Target Alle TMEM63A Produkte
- TMEM63A (Transmembrane Protein 63A (TMEM63A))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMEM63A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMEM63 A antibody was raised against the N terminal of TMEM63
- Aufreinigung
- Affinity purified
- Immunogen
- TMEM63 A antibody was raised using the N terminal of TMEM63 corresponding to a region with amino acids MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMEM63A Blocking Peptide, catalog no. 33R-5872, is also available for use as a blocking control in assays to test for specificity of this TMEM63A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM63A (Transmembrane Protein 63A (TMEM63A))
- Andere Bezeichnung
- TMEM63A (TMEM63A Produkte)
- Hintergrund
- TMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. The exact function of TMEM63A remains unknown.
- Molekulargewicht
- 89 kDa (MW of target protein)
-