PIGF Antikörper (N-Term)
-
- Target Alle PIGF Antikörper anzeigen
- PIGF (Phosphatidylinositol Glycan F (PIGF))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PIGF Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PIGF antibody was raised against the N terminal of PIGF
- Aufreinigung
- Affinity purified
- Immunogen
- PIGF antibody was raised using the N terminal of PIGF corresponding to a region with amino acids MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF
- Top Product
- Discover our top product PIGF Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PIGF Blocking Peptide, catalog no. 33R-6128, is also available for use as a blocking control in assays to test for specificity of this PIGF antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGF antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIGF (Phosphatidylinositol Glycan F (PIGF))
- Andere Bezeichnung
- PIGF (PIGF Produkte)
- Hintergrund
- PIGF is a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. PIGF and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI.
- Molekulargewicht
- 25 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-