IgK Antikörper (N-Term)

Produktnummer ABIN635686

Produktdetails anti-IgK Antikörper

Target: IgK (Immunoglobulin kappa (IgK))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IgK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PIGK antibody was raised against the N terminal of PIGK

Aufreinigung: Affinity purified

Immunogen: PIGK antibody was raised using the N terminal of PIGK corresponding to a region with amino acids MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIGK Blocking Peptide, catalog no. 33R-5803, is also available for use as a blocking control in assays to test for specificity of this PIGK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IgK

Target: IgK (Immunoglobulin kappa (IgK))

Andere Bezeichnung: IGK (IgK Produkte)

Synonyme: IGK@ antikoerper, immunoglobulin kappa locus antikoerper, IGK antikoerper

Hintergrund: PIGK is a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGK is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins.

Molekulargewicht: 43 kDa (MW of target protein)