CLN8 Antikörper

Produktnummer ABIN635687

Produktdetails anti-CLN8 Antikörper

Target: CLN8 (Ceroid-Lipofuscinosis, Neuronal 8 (Epilepsy, Progressive with Mental Retardation) (CLN8))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLN8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CLN8 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNPASDGGTSESIFDLDYASWGIRSTLMVAGFVFYLGVFVVCHQLSSSLN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLN8 Blocking Peptide, catalog no. 33R-6257, is also available for use as a blocking control in assays to test for specificity of this CLN8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLN8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLN8

Target: CLN8 (Ceroid-Lipofuscinosis, Neuronal 8 (Epilepsy, Progressive with Mental Retardation) (CLN8))

Andere Bezeichnung: CLN8 (CLN8 Produkte)

Synonyme: mnd antikoerper, C8orf61 antikoerper, EPMR antikoerper, CLN8, transmembrane ER and ERGIC protein antikoerper, ceroid-lipofuscinosis, neuronal 8 antikoerper, CLN8 antikoerper, Cln8 antikoerper

Hintergrund: CLN8 is a transmembrane protein belonging to a family of proteins containing TLC domains, which are postulated to function in lipid synthesis, transport, or sensing. The protein localizes to the endoplasmic reticulum (ER), and may recycle between the ER and ER-Golgi intermediate compartment.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Regulation of Cell Size, Dicarboxylic Acid Transport