LRCH4 Antikörper

Produktnummer ABIN635689

Produktdetails anti-LRCH4 Antikörper

Target: LRCH4 (Leucine-Rich Repeats and Calponin Homology (CH) Domain Containing 4 (LRCH4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRCH4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: LRCH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEEAVATGTLNLSNRRLKHFPRGAARSYDLSDITQADLSRNRFPEVPEAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRCH4 Blocking Peptide, catalog no. 33R-4887, is also available for use as a blocking control in assays to test for specificity of this LRCH4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRCH4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRCH4

Target: LRCH4 (Leucine-Rich Repeats and Calponin Homology (CH) Domain Containing 4 (LRCH4))

Andere Bezeichnung: LRCH4 (LRCH4 Produkte)

Synonyme: LRN antikoerper, LRRN1 antikoerper, LRRN4 antikoerper, PP14183 antikoerper, 2810008P14Rik antikoerper, 2900069C24Rik antikoerper, AI558103 antikoerper, SAP25 antikoerper, mFLJ00248 antikoerper, si:dkeyp-73c8.2 antikoerper, leucine rich repeats and calponin homology domain containing 4 antikoerper, leucine-rich repeats and calponin homology (CH) domain containing 4 antikoerper, LRCH4 antikoerper, Lrch4 antikoerper, lrch4 antikoerper

Hintergrund: LRCH4 is a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that this protein resembles a receptor.

Molekulargewicht: 73 kDa (MW of target protein)