NTRK3 Antikörper (C-Term)
-
- Target Alle NTRK3 Antikörper anzeigen
- NTRK3 (Neurotrophic tyrosine Kinase, Receptor, Type 3 (NTRK3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NTRK3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NTRK3 antibody was raised against the C terminal of NTRK3
- Aufreinigung
- Affinity purified
- Immunogen
- NTRK3 antibody was raised using the C terminal of NTRK3 corresponding to a region with amino acids ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
- Top Product
- Discover our top product NTRK3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NTRK3 Blocking Peptide, catalog no. 33R-2709, is also available for use as a blocking control in assays to test for specificity of this NTRK3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NTRK3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NTRK3 (Neurotrophic tyrosine Kinase, Receptor, Type 3 (NTRK3))
- Andere Bezeichnung
- NTRK3 (NTRK3 Produkte)
- Synonyme
- TRKC antikoerper, gp145(trkC) antikoerper, trkC antikoerper, AW125844 antikoerper, Ntrk3_tv3 antikoerper, TrkC antikoerper, neurotrophic receptor tyrosine kinase 3 antikoerper, neurotrophic tyrosine kinase, receptor, type 3 antikoerper, NTRK3 antikoerper, Ntrk3 antikoerper
- Hintergrund
- NTRK3 is a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers.
- Molekulargewicht
- 89 kDa (MW of target protein)
- Pathways
- RTK Signalweg, Neurotrophin Signalübertragung, Regulation of Cell Size
-