ST8SIA2 Antikörper (C-Term)

Produktnummer ABIN635706

Produktdetails anti-ST8SIA2 Antikörper

Target: ST8SIA2 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 2 (ST8SIA2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ST8SIA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ST8 SIA2 antibody was raised against the C terminal of ST8 IA2

Aufreinigung: Affinity purified

Immunogen: ST8 SIA2 antibody was raised using the C terminal of ST8 IA2 corresponding to a region with amino acids TGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQAS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ST8SIA2 Blocking Peptide, catalog no. 33R-9089, is also available for use as a blocking control in assays to test for specificity of this ST8SIA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ST8SIA2

Target: ST8SIA2 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 2 (ST8SIA2))

Andere Bezeichnung: ST8SIA2 (ST8SIA2 Produkte)

Synonyme: cb394 antikoerper, id:ibd5161 antikoerper, siat8 antikoerper, SIAT8B antikoerper, HsT19690 antikoerper, ST8SIA-II antikoerper, STX antikoerper, SIAT 8B antikoerper, AI323367 antikoerper, ST8SiaII antikoerper, Siat8b antikoerper, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2 antikoerper, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2 L homeolog antikoerper, st8sia2 antikoerper, st8sia2.L antikoerper, ST8SIA2 antikoerper, St8sia2 antikoerper

Hintergrund: ST8SIA2 is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. ST8SIA2 may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29.

Molekulargewicht: 42 kDa (MW of target protein)