MTCH1 Antikörper

Produktnummer ABIN635711

Produktdetails anti-MTCH1 Antikörper

Target: MTCH1 (Mitochondrial Carrier 1 (MTCH1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTCH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: MTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTCH1 Blocking Peptide, catalog no. 33R-6803, is also available for use as a blocking control in assays to test for specificity of this MTCH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTCH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTCH1

Target: MTCH1 (Mitochondrial Carrier 1 (MTCH1))

Andere Bezeichnung: MTCH1 (MTCH1 Produkte)

Synonyme: CGI-64 antikoerper, PIG60 antikoerper, PSAP antikoerper, SLC25A49 antikoerper, 2310034O17Rik antikoerper, AI255158 antikoerper, AU018396 antikoerper, C77849 antikoerper, MTCH1 antikoerper, mitochondrial carrier 1 antikoerper, MTCH1 antikoerper, Mtch1 antikoerper

Hintergrund: MTCH1 is a potential mitochondrial transporter. It may play a role in apoptosis.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity, SARS-CoV-2 Protein Interaktom