MTCH1 Antikörper
-
- Target Alle MTCH1 Antikörper anzeigen
- MTCH1 (Mitochondrial Carrier 1 (MTCH1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MTCH1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- MTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA
- Top Product
- Discover our top product MTCH1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MTCH1 Blocking Peptide, catalog no. 33R-6803, is also available for use as a blocking control in assays to test for specificity of this MTCH1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTCH1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTCH1 (Mitochondrial Carrier 1 (MTCH1))
- Andere Bezeichnung
- MTCH1 (MTCH1 Produkte)
- Hintergrund
- MTCH1 is a potential mitochondrial transporter. It may play a role in apoptosis.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity, SARS-CoV-2 Protein Interaktom
-