NDST4 Antikörper

Produktnummer ABIN635713

Produktdetails anti-NDST4 Antikörper

Target: NDST4 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NDST4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: NDST4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDWTIFQYNHSTYQPVLLTELQTEKSLSSLSSKTLFATVIQDLGLHDGIQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDST4 Blocking Peptide, catalog no. 33R-2334, is also available for use as a blocking control in assays to test for specificity of this NDST4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDST4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NDST4

Target: NDST4 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4))

Andere Bezeichnung: NDST4 (NDST4 Produkte)

Synonyme: NDST-4 antikoerper, NHSST4 antikoerper, 4930439H17Rik antikoerper, N-deacetylase and N-sulfotransferase 4 antikoerper, N-deacetylase/N-sulfotransferase (heparin glucosaminyl) 4 antikoerper, NDST4 antikoerper, Ndst4 antikoerper

Hintergrund: NDST4 is an essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. It modifies the GlcNAc-GlcA dissacharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. NDST4 has low deacetylase activity but high sulfotransferase activity.

Molekulargewicht: 101 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process