MPPE1 Antikörper (N-Term)

Produktnummer ABIN635730

Produktdetails anti-MPPE1 Antikörper

Target: MPPE1 (Metallophosphoesterase 1 (MPPE1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MPPE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MPPE1 antibody was raised against the N terminal of MPPE1

Aufreinigung: Affinity purified

Immunogen: MPPE1 antibody was raised using the N terminal of MPPE1 corresponding to a region with amino acids WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MPPE1 Blocking Peptide, catalog no. 33R-9972, is also available for use as a blocking control in assays to test for specificity of this MPPE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPPE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MPPE1

Target: MPPE1 (Metallophosphoesterase 1 (MPPE1))

Andere Bezeichnung: MPPE1 (MPPE1 Produkte)

Synonyme: zgc:112219 antikoerper, PGAP5 antikoerper, A530095G11 antikoerper, pgap5 antikoerper, MPPE1 antikoerper, metallophosphoesterase 1 antikoerper, metallophosphoesterase 1 L homeolog antikoerper, MPPE1 antikoerper, mppe1 antikoerper, CpipJ_CPIJ008075 antikoerper, Bm1_07905 antikoerper, Tsp_09516 antikoerper, Mppe1 antikoerper, mppe1.L antikoerper

Hintergrund: The specific function of MPPE1 is not yet known.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Inositol Metabolic Process