GAL3ST3 Antikörper (C-Term)
-
- Target Alle GAL3ST3 Antikörper anzeigen
- GAL3ST3 (Galactose-3-O-Sulfotransferase 3 (GAL3ST3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GAL3ST3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GAL3 ST3 antibody was raised against the C terminal of GAL3 T3
- Aufreinigung
- Affinity purified
- Immunogen
- GAL3 ST3 antibody was raised using the C terminal of GAL3 T3 corresponding to a region with amino acids VDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEP
- Top Product
- Discover our top product GAL3ST3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GAL3ST3 Blocking Peptide, catalog no. 33R-9463, is also available for use as a blocking control in assays to test for specificity of this GAL3ST3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAL0 T3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GAL3ST3 (Galactose-3-O-Sulfotransferase 3 (GAL3ST3))
- Andere Bezeichnung
- GAL3ST3 (GAL3ST3 Produkte)
- Hintergrund
- GAL3ST3 is a member of the galactose-3-O-sulfotransferase protein family. It catalyzes sulfonation by transferring a sulfate group to the 3' position of galactose in N-acetyllactosamine in both type 2 (Gal-beta-1-4GlcNAc-R) oligosaccharides and core-2-branched O-glycans, but not on type 1 or core-1-branched structures. This gene is different from the GAL3ST2 gene located on chromosome 2 that encodes a related enzyme with distinct tissue distribution and substrate specificities, compared to galactose-3-O-sulfotransferase 3.
- Molekulargewicht
- 49 kDa (MW of target protein)
-