GALC Antikörper (Middle Region)
-
- Target Alle GALC Antikörper anzeigen
- GALC (Galactosylceramidase (GALC))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GALC Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GALC antibody was raised against the middle region of GALC
- Aufreinigung
- Affinity purified
- Immunogen
- GALC antibody was raised using the middle region of GALC corresponding to a region with amino acids LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL
- Top Product
- Discover our top product GALC Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GALC Blocking Peptide, catalog no. 33R-5213, is also available for use as a blocking control in assays to test for specificity of this GALC antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALC antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GALC (Galactosylceramidase (GALC))
- Andere Bezeichnung
- GALC (GALC Produkte)
- Hintergrund
- GALC is a lysosomal protein which hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Mutations in this gene have been associated with Krabbe disease, also known as globoid cell leukodystrophy.
- Molekulargewicht
- 73 kDa (MW of target protein)
-