GALC Antikörper (Middle Region)

Produktnummer ABIN635737

Produktdetails anti-GALC Antikörper

Target: GALC (Galactosylceramidase (GALC))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GALC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GALC antibody was raised against the middle region of GALC

Aufreinigung: Affinity purified

Immunogen: GALC antibody was raised using the middle region of GALC corresponding to a region with amino acids LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GALC Blocking Peptide, catalog no. 33R-5213, is also available for use as a blocking control in assays to test for specificity of this GALC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GALC

Target: GALC (Galactosylceramidase (GALC))

Andere Bezeichnung: GALC (GALC Produkte)

Synonyme: 2310068B06Rik antikoerper, A930008M05Rik antikoerper, AW212969 antikoerper, AW413532 antikoerper, Gacy antikoerper, twi antikoerper, twitcher antikoerper, galc antikoerper, galcl antikoerper, zgc:92561 antikoerper, si:ch211-199l3.4 antikoerper, GALCERase antikoerper, wu:fi04e07 antikoerper, zgc:56444 antikoerper, galactosylceramidase antikoerper, galactosylceramidase a antikoerper, Galactosylceramidase antikoerper, galactosylceramidase L homeolog antikoerper, galactosylceramidase b antikoerper, GALC antikoerper, Galc antikoerper, galca antikoerper, galc antikoerper, Caci_7107 antikoerper, Bacsa_1415 antikoerper, Spico_0384 antikoerper, LOC100304802 antikoerper, galc.L antikoerper, galcb antikoerper

Hintergrund: GALC is a lysosomal protein which hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Mutations in this gene have been associated with Krabbe disease, also known as globoid cell leukodystrophy.

Molekulargewicht: 73 kDa (MW of target protein)