SLC29A2 Antikörper
-
- Target Alle SLC29A2 Antikörper anzeigen
- SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC29A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC29 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV
- Top Product
- Discover our top product SLC29A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC29A2 Blocking Peptide, catalog no. 33R-7199, is also available for use as a blocking control in assays to test for specificity of this SLC29A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))
- Andere Bezeichnung
- SLC29A2 (SLC29A2 Produkte)
- Synonyme
- DER12 antikoerper, ENT2 antikoerper, HNP36 antikoerper, Der12 antikoerper, Ent2 antikoerper, Hnp36 antikoerper, ent2 antikoerper, der12 antikoerper, hnp36 antikoerper, MGC82995 antikoerper, DKFZp468L038 antikoerper, zgc:110527 antikoerper, solute carrier family 29 member 2 antikoerper, solute carrier family 29 (nucleoside transporters), member 2 antikoerper, solute carrier family 29 (equilibrative nucleoside transporter), member 2 L homeolog antikoerper, solute carrier family 29 (equilibrative nucleoside transporter), member 2 antikoerper, SLC29A2 antikoerper, Slc29a2 antikoerper, slc29a2.L antikoerper, slc29a2 antikoerper
- Hintergrund
- SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.
- Molekulargewicht
- 50 kDa (MW of target protein)
-