SLC35A5 Antikörper (N-Term)

Produktnummer ABIN635739

Produktdetails anti-SLC35A5 Antikörper

Target: SLC35A5 (Solute Carrier Family 35, Member A5 (SLC35A5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC35A5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC35 A5 antibody was raised against the N terminal of SLC35 5

Aufreinigung: Affinity purified

Immunogen: SLC35 A5 antibody was raised using the N terminal of SLC35 5 corresponding to a region with amino acids LVKYSANEENKYDYLPTTVNVCSELVKLVFCVLVSFCVIKKDHQSRNLKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC35A5 Blocking Peptide, catalog no. 33R-5521, is also available for use as a blocking control in assays to test for specificity of this SLC35A5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC35A5

Target: SLC35A5 (Solute Carrier Family 35, Member A5 (SLC35A5))

Andere Bezeichnung: SLC35A5 (SLC35A5 Produkte)

Hintergrund: SLC35A5 belongs to the nucleotide-sugar transporter family, SLC35A subfamily. It is a multi-pass membrane protein. The function of the SLC35A5 protein remains unknown.

Molekulargewicht: 48 kDa (MW of target protein)