SLC35A5 Antikörper (N-Term)
-
- Target Alle SLC35A5 Produkte
- SLC35A5 (Solute Carrier Family 35, Member A5 (SLC35A5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Maus, Ratte, Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC35A5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC35 A5 antibody was raised against the N terminal of SLC35 5
- Aufreinigung
- Affinity purified
- Immunogen
- SLC35 A5 antibody was raised using the N terminal of SLC35 5 corresponding to a region with amino acids LVKYSANEENKYDYLPTTVNVCSELVKLVFCVLVSFCVIKKDHQSRNLKY
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC35A5 Blocking Peptide, catalog no. 33R-5521, is also available for use as a blocking control in assays to test for specificity of this SLC35A5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC35A5 (Solute Carrier Family 35, Member A5 (SLC35A5))
- Andere Bezeichnung
- SLC35A5 (SLC35A5 Produkte)
- Synonyme
- DKFZp459B2411 antikoerper, si:bz20i5.1 antikoerper, zgc:66231 antikoerper, 1010001J06Rik antikoerper, AU021179 antikoerper, BB097433 antikoerper, D16Ertd450e antikoerper, D730043G07Rik antikoerper, RGD1564361 antikoerper, solute carrier family 35 member A5 antikoerper, solute carrier family 35, member A5 antikoerper, solute carrier family 35 member A5 S homeolog antikoerper, SLC35A5 antikoerper, slc35a5 antikoerper, slc35a5.S antikoerper, Slc35a5 antikoerper
- Hintergrund
- SLC35A5 belongs to the nucleotide-sugar transporter family, SLC35A subfamily. It is a multi-pass membrane protein. The function of the SLC35A5 protein remains unknown.
- Molekulargewicht
- 48 kDa (MW of target protein)
-