XYLT2 Antikörper (Middle Region)

Produktnummer ABIN635743

Produktdetails anti-XYLT2 Antikörper

Target: XYLT2 (Xylosyltransferase II (XYLT2))

Bindungsspezifität: Middle Region

Reaktivität: Maus, Human, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser XYLT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: XYLT2 antibody was raised against the middle region of XYLT2

Aufreinigung: Affinity purified

Immunogen: XYLT2 antibody was raised using the middle region of XYLT2 corresponding to a region with amino acids PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

XYLT2 Blocking Peptide, catalog no. 33R-7222, is also available for use as a blocking control in assays to test for specificity of this XYLT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XYLT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu XYLT2

Target: XYLT2 (Xylosyltransferase II (XYLT2))

Andere Bezeichnung: XYLT2 (XYLT2 Produkte)

Synonyme: MGC89331 antikoerper, PXYLT2 antikoerper, XT-II antikoerper, XT2 antikoerper, xylT-II antikoerper, xt-II antikoerper, E030002B02Rik antikoerper, xylt-II antikoerper, xylosyltransferase II antikoerper, xylosyltransferase 2 antikoerper, xylt2 antikoerper, XYLT2 antikoerper, Xylt2 antikoerper

Hintergrund: XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases.

Molekulargewicht: 97 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process