XYLT2 Antikörper (Middle Region)
-
- Target Alle XYLT2 Antikörper anzeigen
- XYLT2 (Xylosyltransferase II (XYLT2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Maus, Human, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser XYLT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- XYLT2 antibody was raised against the middle region of XYLT2
- Aufreinigung
- Affinity purified
- Immunogen
- XYLT2 antibody was raised using the middle region of XYLT2 corresponding to a region with amino acids PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW
- Top Product
- Discover our top product XYLT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
XYLT2 Blocking Peptide, catalog no. 33R-7222, is also available for use as a blocking control in assays to test for specificity of this XYLT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XYLT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- XYLT2 (Xylosyltransferase II (XYLT2))
- Andere Bezeichnung
- XYLT2 (XYLT2 Produkte)
- Synonyme
- MGC89331 antikoerper, PXYLT2 antikoerper, XT-II antikoerper, XT2 antikoerper, xylT-II antikoerper, xt-II antikoerper, E030002B02Rik antikoerper, xylt-II antikoerper, xylosyltransferase II antikoerper, xylosyltransferase 2 antikoerper, xylt2 antikoerper, XYLT2 antikoerper, Xylt2 antikoerper
- Hintergrund
- XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases.
- Molekulargewicht
- 97 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-