LIM2 Antikörper (N-Term)
-
- Target Alle LIM2 Antikörper anzeigen
- LIM2 (Lens Intrinsic Membrane Protein 2, 19kDa (LIM2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LIM2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LIM2 antibody was raised against the N terminal of LIM2
- Aufreinigung
- Affinity purified
- Immunogen
- LIM2 antibody was raised using the N terminal of LIM2 corresponding to a region with amino acids GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLY
- Top Product
- Discover our top product LIM2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LIM2 Blocking Peptide, catalog no. 33R-3559, is also available for use as a blocking control in assays to test for specificity of this LIM2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIM2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LIM2 (Lens Intrinsic Membrane Protein 2, 19kDa (LIM2))
- Andere Bezeichnung
- LIM2 (LIM2 Produkte)
- Hintergrund
- This gene encodes an eye lens-specific protein found at the junctions of lens fiber cells, where it may contribute to cell junctional organization.
- Molekulargewicht
- 24 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-