LIM2 Antikörper (N-Term)

Produktnummer ABIN635747

Produktdetails anti-LIM2 Antikörper

Target: LIM2 (Lens Intrinsic Membrane Protein 2, 19kDa (LIM2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LIM2 antibody was raised against the N terminal of LIM2

Aufreinigung: Affinity purified

Immunogen: LIM2 antibody was raised using the N terminal of LIM2 corresponding to a region with amino acids GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LIM2 Blocking Peptide, catalog no. 33R-3559, is also available for use as a blocking control in assays to test for specificity of this LIM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIM2

Target: LIM2 (Lens Intrinsic Membrane Protein 2, 19kDa (LIM2))

Andere Bezeichnung: LIM2 (LIM2 Produkte)

Synonyme: 19kDa antikoerper, 4833403J20 antikoerper, MP19 antikoerper, To3 antikoerper, MP20 antikoerper, Mp19 antikoerper, CTRCT19 antikoerper, MP17 antikoerper, lens intrinsic membrane protein 2 antikoerper, Lim2 antikoerper, LIM2 antikoerper

Hintergrund: This gene encodes an eye lens-specific protein found at the junctions of lens fiber cells, where it may contribute to cell junctional organization.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization