alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C) (C-Term) Antikörper
-
- Target Alle alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C) Antikörper anzeigen
- alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ST6 GALNAC3 antibody was raised against the C terminal of ST6 ALNAC3
- Aufreinigung
- Affinity purified
- Immunogen
- ST6 GALNAC3 antibody was raised using the C terminal of ST6 ALNAC3 corresponding to a region with amino acids HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT
- Top Product
- Discover our top product SIA7C Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ST6GALNAC3 Blocking Peptide, catalog no. 33R-3882, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C)
- Andere Bezeichnung
- ST6GALNAC3 (SIA7C Produkte)
- Hintergrund
- ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids.
- Molekulargewicht
- 35 kDa (MW of target protein)
-