alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C) (C-Term) Antikörper

Produktnummer ABIN635748

Produktdetails

Target: alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C)

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ST6 GALNAC3 antibody was raised against the C terminal of ST6 ALNAC3

Aufreinigung: Affinity purified

Immunogen: ST6 GALNAC3 antibody was raised using the C terminal of ST6 ALNAC3 corresponding to a region with amino acids HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ST6GALNAC3 Blocking Peptide, catalog no. 33R-3882, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C)

Andere Bezeichnung: ST6GALNAC3 (SIA7C Produkte)

Synonyme: fb68h09 antikoerper, siat7c antikoerper, st6GalNAc-III antikoerper, wu:fb67c12 antikoerper, wu:fb68h09 antikoerper, zgc:73301 antikoerper, SIAT7C antikoerper, PRO7177 antikoerper, ST6GALNACIII antikoerper, STY antikoerper, Siat7c antikoerper, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 antikoerper, ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 antikoerper, st6galnac3 antikoerper, ST6GALNAC3 antikoerper, St6galnac3 antikoerper

Hintergrund: ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids.

Molekulargewicht: 35 kDa (MW of target protein)