LRRTM1 Antikörper (Middle Region)
-
- Target Alle LRRTM1 Antikörper anzeigen
- LRRTM1 (Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LRRTM1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LRRTM1 antibody was raised against the middle region of LRRTM1
- Aufreinigung
- Affinity purified
- Immunogen
- LRRTM1 antibody was raised using the middle region of LRRTM1 corresponding to a region with amino acids CALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSG
- Top Product
- Discover our top product LRRTM1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LRRTM1 Blocking Peptide, catalog no. 33R-1644, is also available for use as a blocking control in assays to test for specificity of this LRRTM1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRTM1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRTM1 (Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1))
- Andere Bezeichnung
- LRRTM1 (LRRTM1 Produkte)
- Synonyme
- im:6904481 antikoerper, 4632401D06Rik antikoerper, AW125451 antikoerper, leucine rich repeat transmembrane neuronal 1 antikoerper, lrrtm1 antikoerper, LRRTM1 antikoerper, Lrrtm1 antikoerper
- Hintergrund
- LRRTM1 may play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons.
- Molekulargewicht
- 59 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-