FLT3LG Antikörper (N-Term)

Produktnummer ABIN635754

Produktdetails anti-FLT3LG Antikörper

Target: FLT3LG (Fms-Related tyrosine Kinase 3 Ligand (FLT3LG))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FLT3LG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Flt3 Ligand antibody was raised against the N terminal of FLT3 LG

Aufreinigung: Affinity purified

Immunogen: Flt3 Ligand antibody was raised using the N terminal of FLT3 LG corresponding to a region with amino acids TVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Flt3 Ligand Blocking Peptide, catalog no. 33R-9360, is also available for use as a blocking control in assays to test for specificity of this Flt3 Ligand antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLT0 G antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FLT3LG

Target: FLT3LG (Fms-Related tyrosine Kinase 3 Ligand (FLT3LG))

Andere Bezeichnung: Flt3 Ligand (FLT3LG Produkte)

Synonyme: Flt3lg antikoerper, Ly72L antikoerper, FL antikoerper, FLT3L antikoerper, Vegfr3 antikoerper, fms related tyrosine kinase 3 ligand antikoerper, FMS-like tyrosine kinase 3 ligand antikoerper, fms-related tyrosine kinase 4 antikoerper, fms-related tyrosine kinase 3 ligand antikoerper, FLT3LG antikoerper, Flt3l antikoerper, Flt4 antikoerper, Flt3lg antikoerper

Hintergrund: FLT3LG stimulates the proliferation of early hematopoietic cells and synergizes well with a number of other colony stimulating factors and interleukins.

Molekulargewicht: 26 kDa (MW of target protein)

Pathways: RTK Signalweg