PGAP3 Antikörper (N-Term)

Produktnummer ABIN635756

Produktdetails anti-PGAP3 Antikörper

Target: PGAP3 (Post-GPI Attachment To Proteins 3 (PGAP3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PGAP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PERLD1 antibody was raised against the N terminal of PERLD1

Aufreinigung: Affinity purified

Immunogen: PERLD1 antibody was raised using the N terminal of PERLD1 corresponding to a region with amino acids AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PERLD1 Blocking Peptide, catalog no. 33R-1204, is also available for use as a blocking control in assays to test for specificity of this PERLD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PERLD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PGAP3

Target: PGAP3 (Post-GPI Attachment To Proteins 3 (PGAP3))

Andere Bezeichnung: PERLD1 (PGAP3 Produkte)

Synonyme: GB10206 antikoerper, AGLA546 antikoerper, CAB2 antikoerper, PER1 antikoerper, PERLD1 antikoerper, PP1498 antikoerper, D430035D22Rik antikoerper, Perld1 antikoerper, perld1 antikoerper, pgap3 antikoerper, post-GPI attachment to proteins factor 3 antikoerper, post-GPI attachment to proteins 3 antikoerper, post-GPI attachment to proteins 3 L homeolog antikoerper, LOC412085 antikoerper, PGAP3 antikoerper, Pgap3 antikoerper, pgap3.L antikoerper, pgap3 antikoerper

Hintergrund: PERLD1 is involved in the lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist in the generation of 2 saturated fatty chains at the sn-2 position of GPI-anchors proteins.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Inositol Metabolic Process