Tetraspanin 5 Antikörper (Middle Region)

Produktnummer ABIN635758

Produktdetails anti-Tetraspanin 5 Antikörper

Target: Tetraspanin 5 (TSPAN5)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tetraspanin 5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Tetraspanin 5 antibody was raised against the middle region of TSPAN5

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 5 antibody was raised using the middle region of TSPAN5 corresponding to a region with amino acids ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 5 Blocking Peptide, catalog no. 33R-1526, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tetraspanin 5

Target: Tetraspanin 5 (TSPAN5)

Andere Bezeichnung: Tetraspanin 5 (TSPAN5 Produkte)

Synonyme: net4 antikoerper, net-4 antikoerper, tm4sf9 antikoerper, tspan-5 antikoerper, MGC84872 antikoerper, tspan5 antikoerper, zgc:103404 antikoerper, MGC145322 antikoerper, NET-4 antikoerper, NET4 antikoerper, TM4SF9 antikoerper, TSPAN-5 antikoerper, 2810455A09Rik antikoerper, 4930505M03Rik antikoerper, AU024142 antikoerper, Tm4sf9 antikoerper, Tspan-5 antikoerper, tetraspanin 5 S homeolog antikoerper, tetraspanin 5 antikoerper, tetraspanin 5a antikoerper, tetraspanin-3 antikoerper, tetraspanin 5 L homeolog antikoerper, tspan5.S antikoerper, TSPAN5 antikoerper, tspan5a antikoerper, LOC725690 antikoerper, tspan5 antikoerper, tspan5.L antikoerper, Tspan5 antikoerper

Hintergrund: TSPAN5 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Molekulargewicht: 30 kDa (MW of target protein)