Tetraspanin 15 Antikörper (C-Term)

Produktnummer ABIN635763

Produktdetails anti-Tetraspanin 15 Antikörper

Target: Tetraspanin 15 (TSPAN15)

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tetraspanin 15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Tetraspanin 15 antibody was raised against the C terminal of TSPAN15

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 15 antibody was raised using the C terminal of TSPAN15 corresponding to a region with amino acids LGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 15 Blocking Peptide, catalog no. 33R-4975, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tetraspanin 15

Target: Tetraspanin 15 (TSPAN15)

Andere Bezeichnung: Tetraspanin 15 (TSPAN15 Produkte)

Synonyme: MGC82964 antikoerper, zgc:110375 antikoerper, 2700063A19Rik antikoerper, NET-7 antikoerper, NET7 antikoerper, TM4SF15 antikoerper, 1110036D12Rik antikoerper, AW048364 antikoerper, Tm4sf15 antikoerper, tetraspanin 15 antikoerper, tetraspanin 15 L homeolog antikoerper, TSPAN15 antikoerper, tspan15.L antikoerper, tspan15 antikoerper, Tspan15 antikoerper

Hintergrund: TSPAN15 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene.

Molekulargewicht: 33 kDa (MW of target protein)