Tetraspanin 15 Antikörper (C-Term)
-
- Target Alle Tetraspanin 15 (TSPAN15) Antikörper anzeigen
- Tetraspanin 15 (TSPAN15)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Tetraspanin 15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Tetraspanin 15 antibody was raised against the C terminal of TSPAN15
- Aufreinigung
- Affinity purified
- Immunogen
- Tetraspanin 15 antibody was raised using the C terminal of TSPAN15 corresponding to a region with amino acids LGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGC
- Top Product
- Discover our top product TSPAN15 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Tetraspanin 15 Blocking Peptide, catalog no. 33R-4975, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Tetraspanin 15 (TSPAN15)
- Andere Bezeichnung
- Tetraspanin 15 (TSPAN15 Produkte)
- Hintergrund
- TSPAN15 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene.
- Molekulargewicht
- 33 kDa (MW of target protein)
-