ZP4 Antikörper (N-Term)
-
- Target Alle ZP4 Antikörper anzeigen
- ZP4 (Zona Pellucida Glycoprotein 4 (ZP4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZP4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ZP4 antibody was raised against the N terminal of ZP4
- Aufreinigung
- Affinity purified
- Immunogen
- ZP4 antibody was raised using the N terminal of ZP4 corresponding to a region with amino acids MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT
- Top Product
- Discover our top product ZP4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZP4 Blocking Peptide, catalog no. 33R-6616, is also available for use as a blocking control in assays to test for specificity of this ZP4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZP4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZP4 (Zona Pellucida Glycoprotein 4 (ZP4))
- Andere Bezeichnung
- ZP4 (ZP4 Produkte)
- Hintergrund
- The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix.
- Molekulargewicht
- 49 kDa (MW of target protein)
-