TMEM35 Antikörper (C-Term)
-
- Target Alle TMEM35 Antikörper anzeigen
- TMEM35 (Transmembrane Protein 35 (TMEM35))
- Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMEM35 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMEM35 antibody was raised against the C terminal of TMEM35
- Aufreinigung
- Affinity purified
- Immunogen
- TMEM35 antibody was raised using the C terminal of TMEM35 corresponding to a region with amino acids VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS
- Top Product
- Discover our top product TMEM35 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMEM35 Blocking Peptide, catalog no. 33R-9525, is also available for use as a blocking control in assays to test for specificity of this TMEM35 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM35 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM35 (Transmembrane Protein 35 (TMEM35))
- Andere Bezeichnung
- TMEM35 (TMEM35 Produkte)
- Hintergrund
- TMEM35 is a multi-pass membrane protein. The exact function of TMEM35 remains unknown.
- Molekulargewicht
- 18 kDa (MW of target protein)
-