XYLT2 Antikörper (C-Term)

Produktnummer ABIN635768

Produktdetails anti-XYLT2 Antikörper

Target: XYLT2 (Xylosyltransferase II (XYLT2))

Bindungsspezifität: C-Term

Reaktivität: Maus, Human, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser XYLT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: XYLT2 antibody was raised against the C terminal of XYLT2

Aufreinigung: Affinity purified

Immunogen: XYLT2 antibody was raised using the C terminal of XYLT2 corresponding to a region with amino acids LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

XYLT2 Blocking Peptide, catalog no. 33R-5377, is also available for use as a blocking control in assays to test for specificity of this XYLT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XYLT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu XYLT2

Target: XYLT2 (Xylosyltransferase II (XYLT2))

Andere Bezeichnung: XYLT2 (XYLT2 Produkte)

Synonyme: MGC89331 antikoerper, PXYLT2 antikoerper, XT-II antikoerper, XT2 antikoerper, xylT-II antikoerper, xt-II antikoerper, E030002B02Rik antikoerper, xylt-II antikoerper, xylosyltransferase II antikoerper, xylosyltransferase 2 antikoerper, xylt2 antikoerper, XYLT2 antikoerper, Xylt2 antikoerper

Hintergrund: XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteoglycans including chondroitin sulfate, heparan sulfate, heparin and dermatan sulfate. The enzyme activity, which is increased in scleroderma patients, is a diagnostic marker for the determination of sclerotic activity in systemic sclerosis.

Molekulargewicht: 97 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process