BTNL3 Antikörper (N-Term)

Produktnummer ABIN635769

Produktdetails anti-BTNL3 Antikörper

Target: BTNL3 (Butyrophilin-Like 3 (BTNL3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BTNL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BTNL3 antibody was raised against the N terminal of BTNL3

Aufreinigung: Affinity purified

Immunogen: BTNL3 antibody was raised using the N terminal of BTNL3 corresponding to a region with amino acids EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BTNL3 Blocking Peptide, catalog no. 33R-2333, is also available for use as a blocking control in assays to test for specificity of this BTNL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTNL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BTNL3

Target: BTNL3 (Butyrophilin-Like 3 (BTNL3))

Andere Bezeichnung: BTNL3 (BTNL3 Produkte)

Synonyme: BTNLR antikoerper, Btnl1 antikoerper, butyrophilin like 3 antikoerper, butyrophilin-like 3 antikoerper, butyrophilin-like protein 3 antikoerper, BTNL3 antikoerper, Btnl3 antikoerper, LOC100586129 antikoerper

Hintergrund: The specific function of BTNL3 is not yet known.

Molekulargewicht: 52 kDa (MW of target protein)