SI Antikörper

Produktnummer ABIN635778

Produktdetails anti-SI Antikörper

Target: SI

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SI Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SI antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEFTGPTVSDTLYDVK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SI Blocking Peptide, catalog no. 33R-6891, is also available for use as a blocking control in assays to test for specificity of this SI antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SI antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SI

Target: SI

Abstract: SI Produkte

Synonyme: 2010204N08Rik antikoerper, SI antikoerper, Si-s antikoerper, SUCIMAL antikoerper, sucrase-isomaltase antikoerper, sucrase isomaltase (alpha-glucosidase) antikoerper, SI antikoerper, Sis antikoerper, Si antikoerper

Hintergrund: SI belongs to the glycosyl hydrolase 31 family. It plays an important role in the final stage of carbohydrate digestion.

Molekulargewicht: 209 kDa (MW of target protein)