ADAM19 Antikörper
-
- Target Alle ADAM19 (Adam19) Antikörper anzeigen
- ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADAM19 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG
- Top Product
- Discover our top product Adam19 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADAM19 Blocking Peptide, catalog no. 33R-9408, is also available for use as a blocking control in assays to test for specificity of this ADAM19 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM19 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))
- Andere Bezeichnung
- ADAM19 (Adam19 Produkte)
- Synonyme
- AL024287 antikoerper, M[b] antikoerper, Mltnb antikoerper, MADDAM antikoerper, MLTNB antikoerper, Sox30 antikoerper, fksg34 antikoerper, maddam antikoerper, mltnb antikoerper, a disintegrin and metallopeptidase domain 19 (meltrin beta) antikoerper, ADAM metallopeptidase domain 19 antikoerper, ADAM metallopeptidase domain 19 S homeolog antikoerper, Adam19 antikoerper, ADAM19 antikoerper, adam19.S antikoerper
- Hintergrund
- ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.
- Molekulargewicht
- 82 kDa (MW of target protein)
-