ADAM7 Antikörper (C-Term)

Produktnummer ABIN635785

Produktdetails anti-ADAM7 Antikörper

Target: ADAM7 (ADAM Metallopeptidase Domain 7 (ADAM7))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAM7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ADAM7 antibody was raised against the C terminal of ADAM7

Aufreinigung: Affinity purified

Immunogen: ADAM7 antibody was raised using the C terminal of ADAM7 corresponding to a region with amino acids PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADAM7 Blocking Peptide, catalog no. 33R-7385, is also available for use as a blocking control in assays to test for specificity of this ADAM7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADAM7

Target: ADAM7 (ADAM Metallopeptidase Domain 7 (ADAM7))

Andere Bezeichnung: ADAM7 (ADAM7 Produkte)

Synonyme: ADAM7 antikoerper, 9230104J12Rik antikoerper, EAP1 antikoerper, EAPI antikoerper, ADAM 7 antikoerper, ADAM-7 antikoerper, GP-83 antikoerper, GP83 antikoerper, 7 antikoerper, ADAM antikoerper, EAP antikoerper, EAP I antikoerper, I antikoerper, ADAM metallopeptidase domain 7 antikoerper, a disintegrin and metallopeptidase domain 7 antikoerper, ADAM7 antikoerper, Adam7 antikoerper

Hintergrund: The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.

Molekulargewicht: 83 kDa (MW of target protein)

Pathways: Notch Signalweg